PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00505.1.g00040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 118aa    MW: 12741.5 Da    PI: 11.1114
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00505.1.g00040.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind76.35.5e-242685261
                                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
                  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61
                                  Fl+k+++++e+++++e+isw e+g+sfvv+++ efa+++Lp +Fkh nf+SFvRQLn+Y 
  Zmw_sc00505.1.g00040.1.am.mk 26 FLTKTHQMVEERATDEVISWAEQGRSFVVWKPVEFARDLLPLHFKHCNFSSFVRQLNTYV 85
                                  9**********************************************************4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004157.2E-2522113IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467851.35E-212288IPR011991Winged helix-turn-helix DNA-binding domain
Gene3DG3DSA:1.10.10.103.4E-262291IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004472.5E-202685IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.6E-132649IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.6E-136476IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000564.6E-137789IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MAGATAAGRP KGSGGRGGGG GGPAPFLTKT HQMVEERATD EVISWAEQGR SFVVWKPVEF  60
ARDLLPLHFK HCNFSSFVRQ LNTYVPFVVT KRNIAAQASC VGQQRKTKII ARAGRGDN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1hks_A7e-161984165HEAT-SHOCK TRANSCRIPTION FACTOR
1hkt_A7e-161984165HEAT-SHOCK TRANSCRIPTION FACTOR
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11321GGRGGGGGG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150318.19e-42heat shock factor protein 4
SwissprotQ67TP91e-37HSFB1_ORYSJ; Heat stress transcription factor B-1
TrEMBLA0A096SBC62e-43A0A096SBC6_MAIZE; Uncharacterized protein
STRINGGRMZM2G139535_P025e-43(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394